PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000501518
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 177aa    MW: 20396.1 Da    PI: 8.6301
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000501518genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.92.3e-54101401129
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                    +ppGfrFhPtdeel+ +yL+kkv+ + ++l +vi evd++k+ePwdL++  ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++
  MDP0000501518  10 VPPGFRFHPTDEELLYYYLRKKVSYEAIDL-DVIGEVDLNKLEPWDLKEkcRIGSgPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKAIH 104
                    69****************************.9***************952444443456************************************* PP

            NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     ++++ +g++ktLvfy+grap+g+ktdW+mheyrle
  MDP0000501518 105 LTSSKRIGMRKTLVFYTGRAPHGQKTDWIMHEYRLE 140
                    **********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-555144IPR003441NAC domain
PROSITE profilePS5100552.47310159IPR003441NAC domain
PfamPF023656.8E-2911139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MAAGNGQLTV PPGFRFHPTD EELLYYYLRK KVSYEAIDLD VIGEVDLNKL EPWDLKEKCR  60
IGSGPQNEWY FFSHKDKKYP TGTRTNRATT AGFWKATGRD KAIHLTSSKR IGMRKTLVFY  120
TGRAPHGQKT DWIMHEYRLE DDNITADQVQ FFSSNVEKEE GVRLKKCENP FPLIDT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D4e-48713917145NAC domain-containing protein 19
3swp_C4e-48713917145NAC domain-containing protein 19
3swp_B4e-48713917145NAC domain-containing protein 19
3swp_A4e-48713917145NAC domain-containing protein 19
3swm_D4e-48713917145NAC domain-containing protein 19
3swm_C4e-48713917145NAC domain-containing protein 19
3swm_B4e-48713917145NAC domain-containing protein 19
3swm_A4e-48713917145NAC domain-containing protein 19
4dul_B5e-48713914142NAC domain-containing protein 19
4dul_A5e-48713914142NAC domain-containing protein 19
1ut7_B5e-48713914142NO APICAL MERISTEM PROTEIN
1ut7_A5e-48713914142NO APICAL MERISTEM PROTEIN
1ut4_B5e-48713914142NO APICAL MERISTEM PROTEIN
1ut4_A5e-48713914142NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008383227.11e-110PREDICTED: protein SOMBRERO-like
RefseqXP_008383226.11e-110PREDICTED: protein SOMBRERO-like
SwissprotQ9MA173e-92SMB_ARATH; Protein SOMBRERO
TrEMBLM5WZ811e-107M5WZ81_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s18420.13e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72043447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.33e-83NAC family protein